Lineage for d1u7xa_ (1u7x A:)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) 
Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins)
contains a conserved all-alpha subdomain at the C-terminal extensionProtein Tyrosyl-tRNA synthetase (TyrRS) [52376] (6 species) 
Species Methanococcus jannaschii [TaxId:2190] [89611] (9 PDB entries) 
Domain d1u7xa_: 1u7x A: [240779]
automated match to d2ag6a_
complexed with k; mutant
Details for d1u7xa_
PDB Entry: 1u7x (more details), 3 Å
PDB Description: crystal structure of a mutant m. jannashii tyrosyl-trna synthetase specific for o-methyl-tyrosine
PDB Compounds: (A:) Tyrosyl-tRNA synthetaseSCOPe Domain Sequences for d1u7xa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u7xa_ c.26.1.1 (A:) Tyrosyl-tRNA synthetase (TyrRS) {Methanococcus jannaschii [TaxId: 2190]}
mdefemikrntseiiseeelrevlkkdeksaqigfepsgkihlghylqikkmidlqnagf
diiilladlhaylnqkgeldeirkigdynkkvfeamglkakyvygstfqldkdytlnvyr
lalkttlkrarrsmeliaredenpkvaeviypimqvnaihypgvdvavggmeqrkihmla
rellpkkvvcihnpvltgldgegkmssskgnfiavddspeeirakikkaycpagvvegnp
imeiakyfleypltikrpekfggdltvnsyeeleslfknkelhpmdlknavaeelikile
pirkrl
SCOPe Domain Coordinates for d1u7xa_:
Click to download the PDB-style file with coordinates for d1u7xa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1u7xa_:
- d1u7xa_ first appeared in SCOPe 2.04
- d1u7xa_ appears in SCOPe 2.05
- d1u7xa_ appears in SCOPe 2.07
- d1u7xa_ appears in the current release, SCOPe 2.08
View in 3D
