Lineage for d1u73a_ (1u73 A:)
- Root: SCOPe 2.01
Class a: All alpha proteins [46456] (284 folds) 
Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
common core: 2 helices, disulfide-linked, and a calcium-binding loopSuperfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) 
Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins) Protein Snake phospholipase A2 [48624] (35 species) 
Species Jararacussu (Bothrops jararacussu) [TaxId:8726] [101487] (8 PDB entries)
Uniprot Q8AXY1 17-138
Domain d1u73a_: 1u73 A: [113075]
Details for d1u73a_
PDB Entry: 1u73 (more details), 1.9 Å
PDB Description: Crystal structure of a Dimeric Acidic Platelet Aggregation Inhibitor and Hypotensive Phospholipase A2 from Bothrops jararacussu
PDB Compounds: (A:) hypotensive phospholipase A2SCOPe Domain Sequences for d1u73a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u73a_ a.133.1.2 (A:) Snake phospholipase A2 {Jararacussu (Bothrops jararacussu) [TaxId: 8726]}
slwqfgkminyvmgesgvlqylsygcycglggqgqptdatdrccfvhdccygkvtgcdpk
idsytyskkngdvvcggddpckkqicecdrvattcfrdnkdtydikywfygakncqekse
pc
SCOPe Domain Coordinates for d1u73a_:
Click to download the PDB-style file with coordinates for d1u73a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1u73a_:
- d1u73a_ first appeared in SCOP 1.71
- d1u73a_ appears in SCOP 1.75
- d1u73a_ appears in SCOPe 2.02
- d1u73a_ appears in the current release, SCOPe 2.08
View in 3D
