Lineage for d1u5ta1 (1u5t A:20-164)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694244Family a.4.5.54: Vacuolar sorting protein domain [109692] (3 proteins)
    duplication: tandem repeat of two "winged-helix" domains
  6. 2694269Protein Vacuolar sorting protein SNF8 [109693] (1 species)
  7. 2694270Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [109694] (2 PDB entries)
    Uniprot Q12483 20-232
  8. 2694273Domain d1u5ta1: 1u5t A:20-164 [107684]
    Other proteins in same PDB: d1u5tb1, d1u5tb2, d1u5tc1, d1u5tc2, d1u5td1, d1u5td2
    has additional insertions and/or extensions that are not grouped together

Details for d1u5ta1

PDB Entry: 1u5t (more details), 3.6 Å

PDB Description: Structure of the ESCRT-II endosomal trafficking complex
PDB Compounds: (A:) appears to be functionally related to SNF7; Snf8p

SCOPe Domain Sequences for d1u5ta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u5ta1 a.4.5.54 (A:20-164) Vacuolar sorting protein SNF8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vnktilekqsvelrdqlmvfqerlvefakkhnselqaspefrskfmhmcssigidplslf
drdkhlftvndfyyevclkvieicrqtkdmnggvisfqelekvhfrklnvglddleksid
mlkslecfeifqirgkkflrsvpne

SCOPe Domain Coordinates for d1u5ta1:

Click to download the PDB-style file with coordinates for d1u5ta1.
(The format of our PDB-style files is described here.)

Timeline for d1u5ta1: