Lineage for d1u2xa_ (1u2x A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.72: Ribokinase-like [53612] (3 superfamilies)
core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
potential superfamily: members of this fold have similar functions but different ATP-binding sitesSuperfamily c.72.1: Ribokinase-like [53613] (6 families) 
has extra strand located between strands 2 and 3
Family c.72.1.3: ADP-specific Phosphofructokinase/Glucokinase [64147] (3 proteins)
Pfam PF04587
Protein ADP-specific phosphofructokinase [110707] (1 species) Species Pyrococcus horikoshii [TaxId:53953] [110708] (1 PDB entry)
Uniprot O59355 # PH1645
Domain d1u2xa_: 1u2x A: [107622]
complexed with so4
Details for d1u2xa_
PDB Entry: 1u2x (more details), 2 Å
PDB Description: Crystal Structure of a Hypothetical ADP-dependent Phosphofructokinase from Pyrococcus horikoshii OT3
PDB Compounds: (A:) ADP-specific phosphofructokinaseSCOPe Domain Sequences for d1u2xa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u2xa_ c.72.1.3 (A:) ADP-specific phosphofructokinase {Pyrococcus horikoshii [TaxId: 53953]}
mipehlsiytaynanidaivklnqetiqnlinafdpdevkrrieeypreinepidfvarl
vhtlklgkpaavplvnekmnewfdktfryeeerlggqagiiantlaglkirkviaytpfl
pkrlaelfkkgvlypvvengelqfkpiqeayregdplkinrifefrkglkfklgdetiei
pnsgrfivsarfesisrietredikpflgeigkevdgaifsgyqglrtkysdgkdanyyl
rrakediiefkekdvkihvefasvqdrklrkkiitnilpfvdsvgideaeiaqilsvlgy
reladriftynrledsilggmiildelnfeilqvhttyylmyithrdnplseeelaksle
fgttlaaaraslgdirgpddykvglkvpfnerseyvklrfeeaksrlrmreykvvviptr
lvqnpvltvglgdtisagafltyleflkrh
SCOPe Domain Coordinates for d1u2xa_:
Click to download the PDB-style file with coordinates for d1u2xa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1u2xa_:
- d1u2xa_ first appeared in SCOP 1.69
- d1u2xa_ appears in SCOPe 2.07
View in 3D
