Lineage for d1u0ma2 (1u0m A:202-349)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1881081Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 1881082Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 1881522Family c.95.1.2: Chalcone synthase-like [53914] (9 proteins)
  6. 1881760Protein Putative polyketide synthase SCO1206 [110762] (1 species)
  7. 1881761Species Streptomyces coelicolor [TaxId:1902] [110763] (1 PDB entry)
    Uniprot Q9FCA7
  8. 1881763Domain d1u0ma2: 1u0m A:202-349 [107558]
    complexed with 15p, gol

Details for d1u0ma2

PDB Entry: 1u0m (more details), 2.22 Å

PDB Description: Crystal Structure of 1,3,6,8-Tetrahydroxynaphthalene Synthase (THNS) from Streptomyces coelicolor A3(2): a Bacterial Type III Polyketide Synthase (PKS) Provides Insights into Enzymatic Control of Reactive Polyketide Intermediates
PDB Compounds: (A:) putative polyketide synthase

SCOPe Domain Sequences for d1u0ma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u0ma2 c.95.1.2 (A:202-349) Putative polyketide synthase SCO1206 {Streptomyces coelicolor [TaxId: 1902]}
gtgvrlerngsylipktedwimydvkatgfhflldkrvpatmeplapalkelagehgwda
sdldfyivhaggprilddlstflevdphafrfsratlteygniasavvldalrrlfdegg
veegargllagfgpgitaemslgcwqta

SCOPe Domain Coordinates for d1u0ma2:

Click to download the PDB-style file with coordinates for d1u0ma2.
(The format of our PDB-style files is described here.)

Timeline for d1u0ma2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u0ma1