SCOPe 2.08: Domain d1twfe1: 1twf E:1-143

Lineage for d1twfe1 (1twf E:1-143)

Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
Superfamily c.52.3: Eukaryotic RPB5 N-terminal domain [53036] (1 family)
Family c.52.3.1: Eukaryotic RPB5 N-terminal domain [53037] (2 proteins)
Protein Eukaryotic RPB5 N-terminal domain [53038] (2 species)
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53039] (27 PDB entries)
Uniprot P20434; part of multichain biological unit

Domain d1twfe1: 1twf E:1-143 [112729]
Other proteins in same PDB: d1twfa_, d1twfb_, d1twfc1, d1twfc2, d1twfe2, d1twff_, d1twfh_, d1twfi1, d1twfi2, d1twfj_, d1twfk_, d1twfl_
protein/RNA complex; complexed with mn, utp, zn

Details for d1twfe1

PDB Entry: 1twf (more details), 2.3 Å

PDB Description: RNA polymerase II complexed with UTP at 2.3 A resolution

PDB Compounds: (E:) DNA-directed RNA polymerases I, II, and III 27 kDa polypeptide

SCOPe Domain Sequences for d1twfe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1twfe1 c.52.3.1 (E:1-143) Eukaryotic RPB5 N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mdqenernisrlwrafrtvkemvkdrgyfitqeevelpledfkakycdsmgrpqrkmmsf
qanpteesiskfpdmgslwvefcdepsvgvktmktfvihiqeknfqtgifvyqnnitpsa
mklvpsippatietfneaalvvn

SCOPe Domain Coordinates for d1twfe1:

Click to download the PDB-style file with coordinates for d1twfe1.
(The format of our PDB-style files is described here.)

Timeline for d1twfe1: