Class j: Peptides [58231] (151 folds) |
Fold j.78: C-terminal fragment of thermolysin [63387] (1 superfamily) |
Superfamily j.78.1: C-terminal fragment of thermolysin [63388] (1 family) |
Family j.78.1.1: C-terminal fragment of thermolysin [63389] (1 protein) |
Protein C-terminal fragment of thermolysin [63390] (2 species) |
Species Bacillus thermoproteolyticus [TaxId:1427] [63391] (1 PDB entry) |
Domain d1trla_: 1trl A: [18263] residues 255-316 |
PDB Entry: 1trl (more details)
SCOPe Domain Sequences for d1trla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1trla_ j.78.1.1 (A:) C-terminal fragment of thermolysin {Bacillus thermoproteolyticus [TaxId: 1427]} vvgigrdklgkifyraltqyltptsnfsqlraaavqsatdlygstsqevasvkqafdavg vk
Timeline for d1trla_: