Lineage for d1trla_ (1trl A:)
- Root: SCOPe 2.08
Class j: Peptides [58231] (151 folds) 
Fold j.78: C-terminal fragment of thermolysin [63387] (1 superfamily) Superfamily j.78.1: C-terminal fragment of thermolysin [63388] (1 family) 
Family j.78.1.1: C-terminal fragment of thermolysin [63389] (1 protein) Protein C-terminal fragment of thermolysin [63390] (2 species) 
Species Bacillus thermoproteolyticus [TaxId:1427] [63391] (1 PDB entry) 
Domain d1trla_: 1trl A: [18263]
residues 255-316
Details for d1trla_
PDB Entry: 1trl (more details)
PDB Description: nmr solution structure of the c-terminal fragment 255-316 of thermolysin: a dimer formed by subunits having the native structure
PDB Compounds: (A:) thermolysin fragment 255 - 316SCOPe Domain Sequences for d1trla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1trla_ j.78.1.1 (A:) C-terminal fragment of thermolysin {Bacillus thermoproteolyticus [TaxId: 1427]}
vvgigrdklgkifyraltqyltptsnfsqlraaavqsatdlygstsqevasvkqafdavg
vk
SCOPe Domain Coordinates for d1trla_:
Click to download the PDB-style file with coordinates for d1trla_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1trla_:
- d1trla_ first appeared (with stable ids) in SCOP 1.55
- d1trla_ appears in SCOPe 2.07
View in 3D
