Lineage for d1tq6a_ (1tq6 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1845934Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1846405Protein Interferon-inducible GTPase [110546] (1 species)
    G domain is inserted in all-alpha domain
  7. 1846406Species Mouse (Mus musculus) [TaxId:10090] [110547] (5 PDB entries)
    Uniprot Q9QZ85 # all-alpha domain (14-68,252-415)
  8. 1846412Domain d1tq6a_: 1tq6 A: [107202]
    complexed with gnp, mg

Details for d1tq6a_

PDB Entry: 1tq6 (more details), 2.7 Å

PDB Description: crystal structure of iigp1: a paradigm for interferon inducible p47 resistance gtpases
PDB Compounds: (A:) interferon-inducible GTPase

SCOPe Domain Sequences for d1tq6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tq6a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]}
enndlpssftgyfkkfntgrkiisqeilnlielrmrkgniqltnsaisdalkeidssvln
vavtgetgsgkssfintlrgigneeegaaktgvvevtmerhpykhpnipnvvfwdlpgig
stnfppdtylekmkfyeydffiiisatrfkkndidiakaisamkkefyfvrtkvdsditn
eadgepqtfdkekvlqdirlncvntfrengiaeppifllsnknvchydfpvlmdklisdl
piykrhnfmvslpnitdsviekkrqflkqriwlegfaadlvniipsltflldsdletlkk
smkfyrtvfgvdetslqrlardweievdqveamikspavfkptdeetiqerlsryiqefc
langyllpknsflkeifylkyyfldmvtedaktllkeiclrn

SCOPe Domain Coordinates for d1tq6a_:

Click to download the PDB-style file with coordinates for d1tq6a_.
(The format of our PDB-style files is described here.)

Timeline for d1tq6a_: