Lineage for d1to4a_ (1to4 A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 936733Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. 936734Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)
  6. 936747Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species)
  7. 936776Species Blood fluke (Schistosoma mansoni) [TaxId:6183] [110066] (2 PDB entries)
    Uniprot Q01137
  8. 936777Domain d1to4a_: 1to4 A: [107162]
    complexed with cu, zn

Details for d1to4a_

PDB Entry: 1to4 (more details), 1.55 Å

PDB Description: Structure of the cytosolic Cu,Zn SOD from S. mansoni
PDB Compounds: (A:) superoxide dismutase

SCOPe Domain Sequences for d1to4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1to4a_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Blood fluke (Schistosoma mansoni) [TaxId: 6183]}
gsnmkavcvmtgtagvkgvvkftqetdngpvhvhaefsglkagkhgfhvhefgdttngct
sagahfnptkqehgapedsirhvgdlgnvvagadgnavynatdklislngshsiigrsmv
iheneddlgrgghelskvtgnaggrlacgvvglaae

SCOPe Domain Coordinates for d1to4a_:

Click to download the PDB-style file with coordinates for d1to4a_.
(The format of our PDB-style files is described here.)

Timeline for d1to4a_: