Lineage for d1tn3a_ (1tn3 A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1682071Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1682072Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1682073Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 1682498Protein Tetranectin [56465] (1 species)
    trimeric plasminogen binding protein with an alpha-helical coiled coil
  7. 1682499Species Human (Homo sapiens) [TaxId:9606] [56466] (3 PDB entries)
    Uniprot P05452 85-202
  8. 1682500Domain d1tn3a_: 1tn3 A: [42423]
    complexed with ca, eoh, so4

Details for d1tn3a_

PDB Entry: 1tn3 (more details), 2 Å

PDB Description: the c-type lectin carbohydrate recognition domain of human tetranectin
PDB Compounds: (A:) tetranectin

SCOPe Domain Sequences for d1tn3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tn3a_ d.169.1.1 (A:) Tetranectin {Human (Homo sapiens) [TaxId: 9606]}
alqtvclkgtkvhmkcflaftqtktfheasedcisrggtlstpqtgsendalyeylrqsv
gneaeiwlglndmaaegtwvdmtgariayknweteitaqpdggktencavlsgaangkwf
dkrcrdqlpyicqfgiv

SCOPe Domain Coordinates for d1tn3a_:

Click to download the PDB-style file with coordinates for d1tn3a_.
(The format of our PDB-style files is described here.)

Timeline for d1tn3a_: