Lineage for d1tiqb_ (1tiq B:)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
3 layers: a/b/a; contains mixed beta-sheetSuperfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) 
Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins) 
Protein Protease synthase and sporulation negative regulatory protein PaiA [111100] (1 species) Species Bacillus subtilis [TaxId:1423] [111101] (1 PDB entry)
Uniprot P21340
Domain d1tiqb_: 1tiq B: [107011]
Structural genomics target
complexed with coa, dtt, so4
Details for d1tiqb_
PDB Entry: 1tiq (more details), 1.9 Å
PDB Description: crystal structure of an acetyltransferase (paia) in complex with coa and dtt from bacillus subtilis, northeast structural genomics target sr64.
PDB Compounds: (B:) Protease synthase and sporulation negative regulatory protein PAI 1SCOPe Domain Sequences for d1tiqb_:
Sequence, based on SEQRES records: (download)
>d1tiqb_ d.108.1.1 (B:) Protease synthase and sporulation negative regulatory protein PaiA {Bacillus subtilis [TaxId: 1423]}
svkmkkcsredlqtlqqlsietfndtfkeqnspenmkaylesafnteqlekelsnmssqf
ffiyfdheiagyvkvniddaqseemgaesleieriyiknsfqkhglgkhllnkaieiale
rnkkniwlgvweknenaiafykkmgfvqtgahsfymgdeeqtdlimaktlilehhh
Sequence, based on observed residues (ATOM records): (download)
>d1tiqb_ d.108.1.1 (B:) Protease synthase and sporulation negative regulatory protein PaiA {Bacillus subtilis [TaxId: 1423]}
svkmkkcsredlqtlqqlsietfndenmkaylesafnteqlekelsnmssqfffiyfdhe
iagyvkvniddaqseemgaesleieriyiknsfqkhglgkhllnkaieialernkkniwl
gvweknenaiafykkmgfvqtgahsfymgdeeqtdlimaktlilehhh
SCOPe Domain Coordinates for d1tiqb_:
Click to download the PDB-style file with coordinates for d1tiqb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1tiqb_:
- d1tiqb_ first appeared in SCOP 1.69
- d1tiqb_ appears in SCOPe 2.04
- d1tiqb_ is called d1tiqb1 in SCOPe 2.06
- d1tiqb_ appears in the current release, SCOPe 2.08, called d1tiqb1
View in 3D
