Lineage for d1tgzb_ (1tgz B:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 853596Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 853597Superfamily d.15.1: Ubiquitin-like [54236] (8 families) (S)
  5. 853598Family d.15.1.1: Ubiquitin-related [54237] (38 proteins)
    Pfam PF00240
  6. 853688Protein SUMO-1 (smt3 homologue) [54241] (2 species)
  7. 853694Species Human (Homo sapiens) [TaxId:9606] [54242] (14 PDB entries)
    Uniprot Q93068
  8. 853705Domain d1tgzb_: 1tgz B: [106902]
    Other proteins in same PDB: d1tgza_
    complexed with so4

Details for d1tgzb_

PDB Entry: 1tgz (more details), 2.8 Å

PDB Description: Structure of human Senp2 in complex with SUMO-1
PDB Compounds: (B:) Ubiquitin-like protein SMT3C

SCOP Domain Sequences for d1tgzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tgzb_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]}
eyiklkvigqdsseihfkvkmtthlkklkesycqrqgvpmnslrflfegqriadnhtpke
lgmeeedvievyqeqtgg

SCOP Domain Coordinates for d1tgzb_:

Click to download the PDB-style file with coordinates for d1tgzb_.
(The format of our PDB-style files is described here.)

Timeline for d1tgzb_:

Domains from other chains:
(mouse over for more information)
d1tgza_