Lineage for d1tgoa2 (1tgo A:348-773)

  1. Root: SCOPe 2.04
  2. 1689992Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1692262Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 1692263Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 1692264Family e.8.1.1: DNA polymerase I [56673] (5 proteins)
  6. 1692356Protein Family B DNA polymerase [56680] (7 species)
  7. 1692499Species Thermococcus gorgonarius [TaxId:71997] [56682] (1 PDB entry)
  8. 1692500Domain d1tgoa2: 1tgo A:348-773 [43010]
    Other proteins in same PDB: d1tgoa1

Details for d1tgoa2

PDB Entry: 1tgo (more details), 2.5 Å

PDB Description: thermostable b type dna polymerase from thermococcus gorgonarius
PDB Compounds: (A:) protein (thermostable b DNA polymerase)

SCOPe Domain Sequences for d1tgoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tgoa2 e.8.1.1 (A:348-773) Family B DNA polymerase {Thermococcus gorgonarius [TaxId: 71997]}
stgnlvewfllrkayernelapnkpderelarrresyaggyvkeperglwenivyldfrs
lypsiiithnvspdtlnregceeydvapqvghkfckdfpgfipsllgdlleerqkvkkkm
katidpiekklldyrqraikilansfygyygyakarwyckecaesvtawgrqyiettire
ieekfgfkvlyadtdgffatipgadaetvkkkakefldyinaklpglleleyegfykrgf
fvtkkkyavideedkittrgleivrrdwseiaketqarvleailkhgdveeavrivkevt
eklskyevppeklviyeqitrdlkdykatgphvavakrlaargikirpgtvisyivlkgs
grigdraipfdefdpakhkydaeyyienqvlpaverilrafgyrkedlryqktrqvglga
wlkpkt

SCOPe Domain Coordinates for d1tgoa2:

Click to download the PDB-style file with coordinates for d1tgoa2.
(The format of our PDB-style files is described here.)

Timeline for d1tgoa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tgoa1