Lineage for d1tg7a2 (1tg7 A:667-848)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1776981Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 1776982Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 1777717Family b.18.1.27: Beta-galactosidase LacA, domains 4 and 5 [117111] (1 protein)
    duplication: tandem repeat of two similar domains; some sequence similarity to the beta-Galactosidase/glucuronidase N-terminal domain (49803)
  6. 1777718Protein Beta-galactosidase LacA, domains 4 and 5 [117112] (1 species)
  7. 1777719Species Penicillium sp. [TaxId:5081] [117113] (2 PDB entries)
    Uniprot Q700S9 41-1011
  8. 1777720Domain d1tg7a2: 1tg7 A:667-848 [112419]
    Other proteins in same PDB: d1tg7a1, d1tg7a4, d1tg7a5
    complexed with edo, na, nag, po4

Details for d1tg7a2

PDB Entry: 1tg7 (more details), 1.9 Å

PDB Description: native structure of beta-galactosidase from penicillium sp.
PDB Compounds: (A:) beta-galactosidase

SCOPe Domain Sequences for d1tg7a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tg7a2 b.18.1.27 (A:667-848) Beta-galactosidase LacA, domains 4 and 5 {Penicillium sp. [TaxId: 5081]}
apkvqlpslkslkwksvdtlpeakntyddsawtsadhaytnnsahslqtptslfasdygy
htgallfrghftangkektffvqtkggtayghsiwinetyvgswagtsindnnnatytlp
tlqsgknyvitvvidnmgldedwtigsedmknprgiiqyslsgqeasaiswkltgnlgge
ny

SCOPe Domain Coordinates for d1tg7a2:

Click to download the PDB-style file with coordinates for d1tg7a2.
(The format of our PDB-style files is described here.)

Timeline for d1tg7a2: