Lineage for d1tfra1 (1tfr A:183-305)
- Root: SCOPe 2.05
Class a: All alpha proteins [46456] (286 folds) 
Fold a.60: SAM domain-like [47768] (16 superfamilies)
4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
Superfamily a.60.7: 5' to 3' exonuclease, C-terminal subdomain [47807] (2 families) 
Family a.60.7.1: 5' to 3' exonuclease, C-terminal subdomain [47808] (4 proteins) Protein T4 RNase H [47809] (1 species) Species Bacteriophage T4 [TaxId:10665] [47810] (6 PDB entries) 
Domain d1tfra1: 1tfr A:183-305 [18081]
Other proteins in same PDB: d1tfra2
complexed with mg
Details for d1tfra1
PDB Entry: 1tfr (more details), 2.06 Å
PDB Description: rnase h from bacteriophage t4
PDB Compounds: (A:) t4 RNAse hSCOPe Domain Sequences for d1tfra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tfra1 a.60.7.1 (A:183-305) T4 RNase H {Bacteriophage T4 [TaxId: 10665]}
gsaeidcmtkilkgdkkdnvasvkvrsdfwftrvegertpsmktsiveaiandreqakvl
lteseynrykenlvlidfdyipdniasnivnyynsyklpprgkiysyfvkaglskltnsi
nef
SCOPe Domain Coordinates for d1tfra1:
Click to download the PDB-style file with coordinates for d1tfra1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1tfra1:
- d1tfra1 first appeared (with stable ids) in SCOP 1.55, called d1tfr_1
- d1tfra1 appears in SCOPe 2.04
- d1tfra1 appears in SCOPe 2.06
- d1tfra1 appears in the current release, SCOPe 2.08
View in 3D
