SCOPe 2.08: Domain d1tf7a2: 1tf7 A:256-497

Lineage for d1tf7a2 (1tf7 A:256-497)

Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
division into families based on beta-sheet topologies
Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (22 proteins)
core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
Protein Circadian clock protein KaiC [110558] (1 species)
duplication: contains two copies of this domain
Species Synechococcus elongatus PCC 7942 [TaxId:1140] [110559] (3 PDB entries)
Uniprot Q79PF4 14-497
Domain d1tf7a2: 1tf7 A:256-497 [106839]
complexed with atp

Details for d1tf7a2

PDB Entry: 1tf7 (more details), 2.8 Å

PDB Description: Crystal Structure of Circadian Clock Protein KaiC

PDB Compounds: (A:) KaiC

SCOPe Domain Sequences for d1tf7a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus elongatus PCC 7942 [TaxId: 1140]}
qrssnvrvssgvvrldemcgggffkdsiilatgatgtgktllvsrfvenacankerailf
ayeesraqllrnayswgmdfeemerqnllkivcaypesagledhlqiikseindfkpari
aidslsalargvsnnafrqfvigvtgyakqeeitglftntsdqfmgahsitdshistitd
tiillqyveirgemsrainvfkmrgswhdkairefmisdkgpdikdsfrnferiisgspt
ri

SCOPe Domain Coordinates for d1tf7a2:

Click to download the PDB-style file with coordinates for d1tf7a2.
(The format of our PDB-style files is described here.)

Timeline for d1tf7a2: