SCOPe 2.08: Domain d1tedb1: 1ted B:31-246

Lineage for d1tedb1 (1ted B:31-246)

Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

Fold c.95: Thiolase-like [53900] (1 superfamily)
consists of two similar domains related by pseudo dyad; duplication
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

Superfamily c.95.1: Thiolase-like [53901] (3 families)
Family c.95.1.2: Chalcone synthase-like [53914] (15 proteins)
Protein Polyketide synthase PKS18, N-terminal domain [419034] (1 species)
Species Mycobacterium tuberculosis [TaxId:1773] [419518] (2 PDB entries)
Uniprot Q79FQ0
Domain d1tedb1: 1ted B:31-246 [238544]
Other proteins in same PDB: d1teda2, d1tedb2, d1tedc2, d1tedd2
complexed with myr
has additional insertions and/or extensions that are not grouped together

Details for d1tedb1

PDB Entry: 1ted (more details), 2.25 Å

PDB Description: Crystal structure of a type III polyketide synthase PKS18 from Mycobacterium tuberculosis

PDB Compounds: (B:) pks18

SCOPe Domain Sequences for d1tedb1:

Sequence, based on SEQRES records: (download)

>d1tedb1 c.95.1.2 (B:31-246) Polyketide synthase PKS18, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]}
tvavieglatgtprrvvnqsdaadrvaelfldpgqreriprvyqksrittrrmavdplda
kfdvfrrepatirdrmhlfyehavplavdvskralaglpyraaeigllvlatstgfiapg
vdvaivkelglspsisrvvvnfmgcaaamnalgtatnyvrahpamkalvvcielcsvnav
faddindvvihslfgdgcaalvigasqvqeklepgk

Sequence, based on observed residues (ATOM records): (download)

>d1tedb1 c.95.1.2 (B:31-246) Polyketide synthase PKS18, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]}
tvavieglatgtprrvvnqsdaadrvaelgqreriprvyqksrittrrmavdpldakfdv
frrepatirdrmhlfyehavplavdvskralaglpyraaeigllvlatstgfiapgvdva
ivkelglspsisrvvvnfmgcaaamnalgtatnyvrahpamkalvvcielcsvnavfadd
indvvihslfgdgcaalvigasqvqeklepgk

SCOPe Domain Coordinates for d1tedb1:

Click to download the PDB-style file with coordinates for d1tedb1.
(The format of our PDB-style files is described here.)

Timeline for d1tedb1: