Lineage for d1tbma_ (1tbm A:)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
multihelical; consists of two different alpha-helical bundlesSuperfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) 
Family a.211.1.2: PDEase [48548] (7 proteins)
Pfam PF00233; multihelical; can be divided into three subdomains
Protein High-affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A, PDE9A [109942] (2 species) Species Human (Homo sapiens) [TaxId:9606] [109943] (22 PDB entries)
Uniprot O76083 241-566
Domain d1tbma_: 1tbm A: [303079]
automated match to d2hd1a_
complexed with ibm, mg, zn
Details for d1tbma_
PDB Entry: 1tbm (more details), 2.23 Å
PDB Description: Crystal structure of phosphodiesterase 9 shows orientation variation of inhibitor IBMX binding
PDB Compounds: (A:) cGMP phosphodiesterase A2SCOPe Domain Sequences for d1tbma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tbma_ a.211.1.2 (A:) High-affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A, PDE9A {Human (Homo sapiens) [TaxId: 9606]}
ptypkyllspetiealrkptfdvwlwepnemlsclehmyhdlglvrdfsinpvtlrrwlf
cvhdnyrnnpfhnfrhcfcvaqmmysmvwlcslqekfsqtdililmtaaichdldhpgyn
ntyqinartelavryndisplenhhcavafqilaepecnifsnippdgfkqirqgmitli
latdmarhaeimdsfkekmenfdysneehmtllkmilikccdisnevrpmevaepwvdcl
leeyfmqsdrekseglpvapfmdrdkvtkataqigfikfvlipmfetvtklfpmveeiml
qplwesrdryeelkriddamkelqkk
SCOPe Domain Coordinates for d1tbma_:
Click to download the PDB-style file with coordinates for d1tbma_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1tbma_:
- d1tbma_ first appeared in SCOPe 2.06
- d1tbma_ appears in SCOPe 2.07
View in 3D
