Lineage for d1t8pa_ (1t8p A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the restSuperfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) 
Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (4 proteins) 
Protein Phosphoglycerate mutase [53256] (6 species) 
Species Human (Homo sapiens) [TaxId:9606] [110656] (1 PDB entry)
Uniprot P07738
Domain d1t8pa_: 1t8p A: [106667]
Details for d1t8pa_
PDB Entry: 1t8p (more details), 2.5 Å
PDB Description: Crystal structure of Human erythrocyte 2,3-bisphosphoglycerate mutase
PDB Compounds: (A:) Bisphosphoglycerate mutaseSCOPe Domain Sequences for d1t8pa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t8pa_ c.60.1.1 (A:) Phosphoglycerate mutase {Human (Homo sapiens) [TaxId: 9606]}
skyklimlrhgegawnkenrfcswvdqklnsegmeearncgkqlkalnfefdlvftsvln
rsihtawlileelgqewvpvesswrlnerhygaliglnreqmalnhgeeqvrlwrrsynv
tpppieeshpyyqeiyndrrykvcdvpldqlprseslkdvlerllpywneriapevlrgk
tilisahgnssrallkhlegisdediinitlptgvpilleldenlravgphqflgdqeai
qaaikkved
SCOPe Domain Coordinates for d1t8pa_:
Click to download the PDB-style file with coordinates for d1t8pa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1t8pa_:
- d1t8pa_ first appeared in SCOP 1.69
- d1t8pa_ appears in SCOPe 2.07
View in 3D
