Lineage for d1t87a_ (1t87 A:)
- Root: SCOP 1.75
Class a: All alpha proteins [46456] (284 folds) 
Fold a.104: Cytochrome P450 [48263] (1 superfamily)
multihelicalSuperfamily a.104.1: Cytochrome P450 [48264] (1 family) 
Family a.104.1.1: Cytochrome P450 [48265] (22 proteins) 
Protein Cytochrome P450-CAM [48266] (1 species) Species Pseudomonas putida [TaxId:303] [48267] (60 PDB entries)
Uniprot P00183
Domain d1t87a_: 1t87 A: [106653]
Details for d1t87a_
PDB Entry: 1t87 (more details), 1.8 Å
PDB Description: crystal structure of the ferrous co-bound cytochrome p450cam (c334a)
PDB Compounds: (A:) Cytochrome P450-camSCOP Domain Sequences for d1t87a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t87a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]}
nanlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatr
gqlireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdkl
enriqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrp
dgsmtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllv
ggldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyef
hgvqlkkgdqillpqmlsglderenaapmhvdfsrqkvshttfghgshlclgqhlarrei
ivtlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav
SCOP Domain Coordinates for d1t87a_:
Click to download the PDB-style file with coordinates for d1t87a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1t87a_:
- d1t87a_ first appeared in SCOP 1.69
- d1t87a_ appears in SCOP 1.73
- d1t87a_ appears in SCOPe 2.01
- d1t87a_ appears in the current release, SCOPe 2.08
View in 3D
