Lineage for d1t64a_ (1t64 A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) 
Family c.42.1.2: Histone deacetylase, HDAC [52773] (4 proteins)
automatically mapped to Pfam PF00850
Protein Histone deacetylase 8, HDAC8 [110587] (1 species) Species Human (Homo sapiens) [TaxId:9606] [110588] (5 PDB entries)
Uniprot Q9BY41 13-375 ! Uniprot Q9BY41
Domain d1t64a_: 1t64 A: [106543]
complexed with ca, na, tsn, zn
Details for d1t64a_
PDB Entry: 1t64 (more details), 1.9 Å
PDB Description: Crystal Structure of human HDAC8 complexed with Trichostatin A
PDB Compounds: (A:) Histone deacetylase 8SCOPe Domain Sequences for d1t64a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t64a_ c.42.1.2 (A:) Histone deacetylase 8, HDAC8 {Human (Homo sapiens) [TaxId: 9606]}
lvpvyiyspeyvsmcdslakipkrasmvhslieayalhkqmrivkpkvasmeematfhtd
aylqhlqkvsqegdddhpdsieyglgydcpategifdyaaaiggatitaaqclidgmckv
ainwsggwhhakkdeasgfcylndavlgilrlrrkferilyvdldlhhgdgvedafsfts
kvmtvslhkfspgffpgtgdvsdvglgkgryysvnvpiqdgiqdekyyqicesvlkevyq
afnpkavvlqlgadtiagdpmcsfnmtpvgigkclkyilqwqlatlilggggynlantar
cwtyltgvilgktlsseipdhefftaygpdyvleitpscrpdrnephriqqilnyikgnl
khvv
SCOPe Domain Coordinates for d1t64a_:
Click to download the PDB-style file with coordinates for d1t64a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1t64a_:
- d1t64a_ first appeared in SCOP 1.69
- d1t64a_ appears in SCOPe 2.07
View in 3D
