Lineage for d1t3aa_ (1t3a A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1211973Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 1211974Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 1212225Family d.92.1.7: Clostridium neurotoxins, catalytic domain [55512] (2 proteins)
  6. 1212226Protein Botulinum neurotoxin [55513] (4 species)
  7. 1212265Species Clostridium botulinum, serotype E [TaxId:1491] [111082] (2 PDB entries)
    Uniprot Q00496 1-421
  8. 1212268Domain d1t3aa_: 1t3a A: [106339]
    complexed with cl, zn

Details for d1t3aa_

PDB Entry: 1t3a (more details), 2.16 Å

PDB Description: Crystal structure of Clostridium botulinum neurotoxin type E catalytic domain
PDB Compounds: (A:) neurotoxin type E

SCOPe Domain Sequences for d1t3aa_:

Sequence, based on SEQRES records: (download)

>d1t3aa_ d.92.1.7 (A:) Botulinum neurotoxin {Clostridium botulinum, serotype E [TaxId: 1491]}
pkinsfnyndpvndrtilyikpggcqefyksfnimkniwiipernvigttpqdfhpptsl
kngdssyydpnylqsdeekdrflkivtkifnrinnnlsggilleelskanpylgndntpd
nqfhigdasaveikfsngsqdillpnviimgaepdlfetnssnislrnnympsnhgfgsi
aivtfspeysfrfndnsmnefiqdpaltlmhelihslhglygakgittkytitqkqnpli
tnirgtnieefltfggtdlniitsaqsndiytnlladykkiasklskvqvsnpllnpykd
vfeakygldkdasgiysvninkfndifkklysftefdlatkfqvkcrqtyigqykyfkls
nllndsiynisegyninnlkvnfrgqnanlnpriitpitgrglvkkiirfc

Sequence, based on observed residues (ATOM records): (download)

>d1t3aa_ d.92.1.7 (A:) Botulinum neurotoxin {Clostridium botulinum, serotype E [TaxId: 1491]}
pkinsfnyndpvndrtilyikpggcqefyksfnimkniwiipernvigttpqdfhpptsl
kngdssyydpnylqsdeekdrflkivtkifnrinnnlsggilleelskanpylgndntpd
nqfhigdasaveikfsngsqdillpnviimgaepdlfetnssnislrnnympsnhgfgsi
aivtfspeysfrfndnsmnefiqdpaltlmhelihslhglygakgittkytitgtnieef
ltfggtdlniitsaqsndiytnlladykkiasklskvqvsnpllnpykdvfeakygldkd
asgiysvninkfndifkklysftefdlatkfqvkcrqtyigqykyfklsnllndsiynis
egyninnlkvnfrgqnanlnpriitpitgrglvkkiirfc

SCOPe Domain Coordinates for d1t3aa_:

Click to download the PDB-style file with coordinates for d1t3aa_.
(The format of our PDB-style files is described here.)

Timeline for d1t3aa_: