Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins) |
Protein Lactate dehydrogenase [51859] (17 species) |
Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [51863] (13 PDB entries) |
Domain d1t2da1: 1t2d A:1-150 [99084] Other proteins in same PDB: d1t2da2 complexed with gol, nad, oxl |
PDB Entry: 1t2d (more details), 1.1 Å
SCOPe Domain Sequences for d1t2da1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} apkakivlvgsgmiggvmatlivqknlgdvvlfdivknmphgkaldtshtnvmaysnckv sgsntyddlagadvvivtagftkapgksdkewnrddllplnnkimieigghikkncpnaf iivvtnpvdvmvqllhqhsgvpknkiiglg
Timeline for d1t2da1: