Lineage for d1t2da1 (1t2d A:1-150)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similarSuperfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) 
Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins) Protein Lactate dehydrogenase [51859] (17 species) Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [51863] (13 PDB entries) 
Domain d1t2da1: 1t2d A:1-150 [99084]
Other proteins in same PDB: d1t2da2
complexed with gol, nad, oxl
Details for d1t2da1
PDB Entry: 1t2d (more details), 1.1 Å
PDB Description: Plasmodium falciparum lactate dehydrogenase complexed with NAD+ and oxalate
PDB Compounds: (A:) l-lactate dehydrogenaseSCOPe Domain Sequences for d1t2da1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
apkakivlvgsgmiggvmatlivqknlgdvvlfdivknmphgkaldtshtnvmaysnckv
sgsntyddlagadvvivtagftkapgksdkewnrddllplnnkimieigghikkncpnaf
iivvtnpvdvmvqllhqhsgvpknkiiglg
SCOPe Domain Coordinates for d1t2da1:
Click to download the PDB-style file with coordinates for d1t2da1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1t2da1:
- d1t2da1 first appeared in SCOP 1.67
- d1t2da1 appears in SCOPe 2.04
- d1t2da1 appears in SCOPe 2.06
- d1t2da1 appears in the current release, SCOPe 2.08
View in 3D
