Lineage for d1t1nb_ (1t1n B:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 758333Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 758334Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 758373Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 759009Protein Hemoglobin, beta-chain [46500] (24 species)
  7. 759014Species Antarctic fish (Trematomus newnesi) [TaxId:35730] [46513] (4 PDB entries)
  8. 759019Domain d1t1nb_: 1t1n B: [15587]
    Other proteins in same PDB: d1t1na_
    complexed with ace, cmo, hem

Details for d1t1nb_

PDB Entry: 1t1n (more details), 2.2 Å

PDB Description: crystal structure of carbonmonoxy hemoglobin
PDB Compounds: (B:) protein (hemoglobin)

SCOP Domain Sequences for d1t1nb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t1nb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Antarctic fish (Trematomus newnesi) [TaxId: 35730]}
vewtdkersiisdifshmdyddigpkalsrclvvypwtqryfsgfgnlynaegimsnanv
aahgikvlhgldrgmknmdniadaytdlstlhseklhvdpdnfkllsdcitivlaakmgh
aftaetqgafqkflaavvsalgkqyh

SCOP Domain Coordinates for d1t1nb_:

Click to download the PDB-style file with coordinates for d1t1nb_.
(The format of our PDB-style files is described here.)

Timeline for d1t1nb_: