Lineage for d1szva1 (1szv A:1-123)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1427772Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 1428338Superfamily d.110.7: Roadblock/LC7 domain [103196] (1 family) (S)
    alpha-beta(2)-alpha-beta(3)-alpha; structurally most similar to the SNARE-like superfamily with a circular permutation of the terminal helices
  5. 1428339Family d.110.7.1: Roadblock/LC7 domain [103197] (5 proteins)
    Pfam PF03259
  6. 1428357Protein Late endosomal/lysosomal Mp1 interacting protein p14 [111123] (1 species)
  7. 1428358Species Mouse (Mus musculus) [TaxId:10090] [111124] (6 PDB entries)
    Uniprot Q9JHS3
  8. 1428364Domain d1szva1: 1szv A:1-123 [119098]
    automatically matched to d1veub_

Details for d1szva1

PDB Entry: 1szv (more details)

PDB Description: structure of the adaptor protein p14 reveals a profilin-like fold with novel function
PDB Compounds: (A:) Late endosomal/lysosomal Mp1 interacting protein

SCOPe Domain Sequences for d1szva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1szva1 d.110.7.1 (A:1-123) Late endosomal/lysosomal Mp1 interacting protein p14 {Mouse (Mus musculus) [TaxId: 10090]}
mlrpkaltqvlsqantggvqstlllnnegsllaysgygdtdarvtaaiasniwaaydrng
nqafnedslkfilmdcmegrvaitrvanlllcmyaketvgfgmlkakaqalvqyleeplt
qva

SCOPe Domain Coordinates for d1szva1:

Click to download the PDB-style file with coordinates for d1szva1.
(The format of our PDB-style files is described here.)

Timeline for d1szva1: