Lineage for d1syya_ (1syy A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1989402Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1989403Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1991094Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. 1991247Protein Ribonucleotide reductase R2 [47257] (10 species)
  7. 1991258Species Chlamydia trachomatis [TaxId:813] [109786] (1 PDB entry)
    Uniprot O84835
  8. 1991259Domain d1syya_: 1syy A: [106126]
    complexed with fe, pb

Details for d1syya_

PDB Entry: 1syy (more details), 1.7 Å

PDB Description: crystal structure of the r2 subunit of ribonucleotide reductase from chlamydia trachomatis
PDB Compounds: (A:) Ribonucleoside-diphosphate reductase beta chain

SCOPe Domain Sequences for d1syya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1syya_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Chlamydia trachomatis [TaxId: 813]}
qadildgkqkrvnlnskrlvncnqvdvnqlvpikykwawehylngcannwlpteipmgkd
ielwksdrlsederrvillnlgffstaeslvgnnivlaifkhvtnpearqyllrqafeea
vhthtflyiceslgldekeifnayneraaikakddfqmeitgkvldpnfrtdsveglqef
vknlvgyyiimegiffysgfvmilsfhrqnkmigigeqyqyilrdetihlnfgidlingi
keenpeiwtpelqqeivelikravdleieyaqdclprgilglrasmfidyvqhiadrrle
riglkpiyhtknpfpwm

SCOPe Domain Coordinates for d1syya_:

Click to download the PDB-style file with coordinates for d1syya_.
(The format of our PDB-style files is described here.)

Timeline for d1syya_: