SCOPe 2.07: Domain d1sqbb2: 1sqb B:236-439

Lineage for d1sqbb2 (1sqb B:236-439)

Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families)
Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues

Family d.185.1.1: MPP-like [63412] (7 proteins)
Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal

Protein Cytochrome bc1 core subunit 2 [63409] (4 species)
Species Cow (Bos taurus) [TaxId:9913] [56000] (19 PDB entries)
Uniprot P23004

Domain d1sqbb2: 1sqb B:236-439 [105893]
Other proteins in same PDB: d1sqba1, d1sqba2, d1sqbc1, d1sqbc2, d1sqbd1, d1sqbd2, d1sqbe1, d1sqbe2, d1sqbf_, d1sqbg_, d1sqbh_, d1sqbi_, d1sqbj_, d1sqbk_
complexed with azo, fes, hem

Details for d1sqbb2

PDB Entry: 1sqb (more details), 2.69 Å

PDB Description: Crystal Structure Analysis of Bovine Bc1 with Azoxystrobin

PDB Compounds: (B:) Ubiquinol-cytochrome C reductase complex core protein 2, mitochondrial

SCOPe Domain Sequences for d1sqbb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqbb2 d.185.1.1 (B:236-439) Cytochrome bc1 core subunit 2 {Cow (Bos taurus) [TaxId: 9913]}
kakyhggeireqngdslvhaalvaesaaigsaeanafsvlqhvlgagphvkrgsnatssl
yqavakgvhqpfdvsafnasysdsglfgfytisqaasagdvikaaynqvktiaqgnlsnp
dvqaaknklkagylmsvessegfldevgsqalaagsytppstvlqqidavadadvinaak
kfvsgrksmaasgnlghtpfidel

SCOPe Domain Coordinates for d1sqbb2:

Click to download the PDB-style file with coordinates for d1sqbb2.
(The format of our PDB-style files is described here.)

Timeline for d1sqbb2: