Lineage for d1spka_ (1spk A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1783288Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1783415Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 1783416Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 1783482Protein BAI1-associated protein 2-like 1 (RIKEN cDNA 1300006m19) [110161] (1 species)
  7. 1783483Species Mouse (Mus musculus) [TaxId:10090] [110162] (1 PDB entry)
    Uniprot Q9DBJ3 343-401
  8. 1783484Domain d1spka_: 1spk A: [105877]
    Structural genomics target

Details for d1spka_

PDB Entry: 1spk (more details)

PDB Description: solution structure of rsgi ruh-010, an sh3 domain from mouse cdna
PDB Compounds: (A:) RIKEN cDNA 1300006M19

SCOPe Domain Sequences for d1spka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1spka_ b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RIKEN cDNA 1300006m19) {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgqkvktifphtagnnktllsfaqgdvltllipeekdgwlygehdttkargwfps
sytkllsgpssg

SCOPe Domain Coordinates for d1spka_:

Click to download the PDB-style file with coordinates for d1spka_.
(The format of our PDB-style files is described here.)

Timeline for d1spka_: