Lineage for d1skqa1 (1skq A:228-322)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2062589Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2062651Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 2062652Family b.43.3.1: Elongation factors [50448] (10 proteins)
  6. 2062682Protein Elongation factor eEF-1alpha, domain 2 [50454] (2 species)
    eukaryotic and archaeal homologue of EF-Tu
  7. 2062690Species Sulfolobus solfataricus [TaxId:2287] [69276] (2 PDB entries)
    Uniprot P35021
  8. 2062691Domain d1skqa1: 1skq A:228-322 [105678]
    Other proteins in same PDB: d1skqa2, d1skqa3, d1skqb2, d1skqb3
    complexed with gdp, mg

Details for d1skqa1

PDB Entry: 1skq (more details), 1.8 Å

PDB Description: the crystal structure of sulfolobus solfataricus elongation factor 1- alpha in complex with magnesium and gdp
PDB Compounds: (A:) Elongation factor 1-alpha

SCOPe Domain Sequences for d1skqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1skqa1 b.43.3.1 (A:228-322) Elongation factor eEF-1alpha, domain 2 {Sulfolobus solfataricus [TaxId: 2287]}
pvdkplripiqdvysisgvgtvpvgrvesgvlkvgdkivfmpagkvgevrsiethhtkmd
kaepgdnigfnvrgvekkdikrgdvvghpnnpptv

SCOPe Domain Coordinates for d1skqa1:

Click to download the PDB-style file with coordinates for d1skqa1.
(The format of our PDB-style files is described here.)

Timeline for d1skqa1: