Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins) C-terminal domain is beta/alpha-barrel |
Protein N-acylamino acid racemase [110937] (4 species) |
Species Amycolatopsis sp. [TaxId:37632] [110938] (4 PDB entries) Uniprot Q44244; similar activity to a remotely related O-succinylbenzoate synthase from E. coli |
Domain d1sjda2: 1sjd A:1-125 [105633] Other proteins in same PDB: d1sjda1, d1sjdb1, d1sjdc1, d1sjdd1 complexed with npg |
PDB Entry: 1sjd (more details), 1.87 Å
SCOPe Domain Sequences for d1sjda2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sjda2 d.54.1.1 (A:1-125) N-acylamino acid racemase {Amycolatopsis sp. [TaxId: 37632]} mklsgvelrrvqmplvapfrtsfgtqsvrellllravtpagegwgecvtmagplysseyn dgaehvlrhylipallaaeditaakvtpllakfkghrmakgalemavldaelrahersfa aelgs
Timeline for d1sjda2: