Lineage for d1sira1 (1sir A:239-392)
- Root: SCOPe 2.05
Class a: All alpha proteins [46456] (286 folds) 
Fold a.29: Bromodomain-like [47363] (15 superfamilies)
4 helices; bundle; minor mirror variant of up-and-down topology
Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) 
multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
Family a.29.3.1: Medium chain acyl-CoA dehydrogenase-like, C-terminal domain [47204] (10 proteins) 
Protein Glutaryl-CoA dehydrogenase GCDH [109794] (1 species) Species Human (Homo sapiens) [TaxId:9606] [109795] (3 PDB entries)
Uniprot Q92947
Domain d1sira1: 1sir A:239-392 [105587]
Other proteins in same PDB: d1sira2
complexed with fad, nbc
Details for d1sira1
PDB Entry: 1sir (more details), 2.6 Å
PDB Description: The Crystal Structure and Mechanism of Human Glutaryl-CoA Dehydrogenase
PDB Compounds: (A:) Glutaryl-CoA dehydrogenaseSCOPe Domain Sequences for d1sira1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sira1 a.29.3.1 (A:239-392) Glutaryl-CoA dehydrogenase GCDH {Human (Homo sapiens) [TaxId: 9606]}
lggpfgclnnarygiawgvlgasefclhtarqyaldrmqfgvplarnqliqkkladmlte
itlglhaclqlgrlkdqdkaapemvsllkrnncgkaldiarqardmlggngisdeyhvir
hamnleavntyegthdihalilgraitgiqafta
SCOPe Domain Coordinates for d1sira1:
Click to download the PDB-style file with coordinates for d1sira1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1sira1:
- d1sira1 first appeared in SCOP 1.69
- d1sira1 appears in SCOPe 2.04
- d1sira1 appears in SCOPe 2.06
- d1sira1 appears in the current release, SCOPe 2.08
View in 3D
