Lineage for d1sh5a2 (1sh5 A:128-237)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1269975Fold a.40: CH domain-like [47575] (3 superfamilies)
    core: 4 helices: bundle
  4. 1269976Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families) (S)
  5. 1269977Family a.40.1.1: Calponin-homology domain, CH-domain [47577] (10 proteins)
    Pfam PF00307
  6. 1269978Protein Actin binding domain of plectin [89056] (1 species)
    duplication: consists of tandem repeat of two CH domains
  7. 1269979Species Human (Homo sapiens) [TaxId:9606] [89057] (3 PDB entries)
    Uniprot Q9QXS1 182-411
  8. 1269981Domain d1sh5a2: 1sh5 A:128-237 [105544]

Details for d1sh5a2

PDB Entry: 1sh5 (more details), 2 Å

PDB Description: Crystal structure of actin-binding domain of mouse plectin
PDB Compounds: (A:) Plectin 1

SCOPe Domain Sequences for d1sh5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sh5a2 a.40.1.1 (A:128-237) Actin binding domain of plectin {Human (Homo sapiens) [TaxId: 9606]}
qsedmtakeklllwsqrmvegyqglrcdnfttswrdgrlfnaiihrhkpmlidmnkvyrq
tnlenldqafsvaerdlgvtrlldpedvdvpqpdeksiityvsslydamp

SCOPe Domain Coordinates for d1sh5a2:

Click to download the PDB-style file with coordinates for d1sh5a2.
(The format of our PDB-style files is described here.)

Timeline for d1sh5a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1sh5a1