Lineage for d1se4a1 (1se4 A:1-121)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1540029Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1540281Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 1540834Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)
  6. 1540856Protein Staphylococcal enterotoxin B, SEB [50226] (1 species)
  7. 1540857Species Staphylococcus aureus [TaxId:1280] [50227] (14 PDB entries)
  8. 1540863Domain d1se4a1: 1se4 A:1-121 [25187]
    Other proteins in same PDB: d1se4a2
    complexed with lat

Details for d1se4a1

PDB Entry: 1se4 (more details), 1.9 Å

PDB Description: staphylococcal enterotoxin b complexed with lactose
PDB Compounds: (A:) staphylococcal enterotoxin b

SCOPe Domain Sequences for d1se4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1se4a1 b.40.2.2 (A:1-121) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus [TaxId: 1280]}
esqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtklgn
ydnvrvefknkdladkykdkyvdvfganyyyqcyfskktndinshqtdkrktcmyggvte
h

SCOPe Domain Coordinates for d1se4a1:

Click to download the PDB-style file with coordinates for d1se4a1.
(The format of our PDB-style files is described here.)

Timeline for d1se4a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1se4a2