Lineage for d1s96a_ (1s96 A:)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) 
division into families based on beta-sheet topologies
Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
parallel beta-sheet of 5 strands, order 23145
Protein Guanylate kinase [52542] (5 species) 
Species Escherichia coli [TaxId:562] [102338] (6 PDB entries) 
Domain d1s96a_: 1s96 A: [98740]
complexed with po4, unx
Details for d1s96a_
PDB Entry: 1s96 (more details), 2 Å
PDB Description: The 2.0 A X-ray structure of Guanylate Kinase from E.coli
PDB Compounds: (A:) Guanylate kinaseSCOPe Domain Sequences for d1s96a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]}
qgtlyivsapsgagkssliqallktqplydtqvsvshttrqprpgevhgehyffvnhdef
kemisrdaflehaevfgnyygtsreaieqvlatgvdvfldidwqgaqqirqkmpharsif
ilppskieldrrlrgrgqdseeviakrmaqavaemshyaeydylivnddfdtaltdlkti
iraerlrmsrqkqrhdaliskllad
SCOPe Domain Coordinates for d1s96a_:
Click to download the PDB-style file with coordinates for d1s96a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1s96a_:
- d1s96a_ first appeared in SCOP 1.67
- d1s96a_ appears in SCOPe 2.05
- d1s96a_ appears in SCOPe 2.07
- d1s96a_ appears in the current release, SCOPe 2.08
View in 3D
