Lineage for d1s6ya1 (1s6y A:4-172)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similarSuperfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) 
Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins) 
Protein 6-phospho-beta-glucosidase [110428] (2 species) Species Bacillus stearothermophilus [TaxId:1422] [110429] (1 PDB entry)
Uniprot P84135
Domain d1s6ya1: 1s6y A:4-172 [105314]
Other proteins in same PDB: d1s6ya2
Details for d1s6ya1
PDB Entry: 1s6y (more details), 2.31 Å
PDB Description: 2.3A crystal structure of phospho-beta-glucosidase
PDB Compounds: (A:) 6-phospho-beta-glucosidaseSCOPe Domain Sequences for d1s6ya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s6ya1 c.2.1.5 (A:4-172) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]}
rlkiatigggssytpelveglikryhelpvgelwlvdipegkekleivgalakrmvekag
vpieihltldrrraldgadfvttqfrvgglearakderiplkygvigqetngpgglfkgl
rtipvildiirdmeelcpdawlinftnpagmvteavlrytkqekvvglc
SCOPe Domain Coordinates for d1s6ya1:
Click to download the PDB-style file with coordinates for d1s6ya1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1s6ya1:
- d1s6ya1 first appeared in SCOP 1.69
- d1s6ya1 appears in SCOPe 2.05
- d1s6ya1 appears in SCOPe 2.07
- d1s6ya1 appears in the current release, SCOPe 2.08
View in 3D
