Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) |
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
Protein AMPC beta-Lactamase, class C [56618] (4 species) contains small alpha+beta subdomain inserted in the common fold |
Species Enterobacter cloacae, P99, cephalosporinase [TaxId:550] [56620] (10 PDB entries) Uniprot P05364 22-380 ! Uniprot P05364 22-381 |
Domain d1s6ra_: 1s6r A: [98604] complexed with iap |
PDB Entry: 1s6r (more details)
SCOPe Domain Sequences for d1s6ra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s6ra_ e.3.1.1 (A:) AMPC beta-Lactamase, class C {Enterobacter cloacae, P99, cephalosporinase [TaxId: 550]} vsekqlaevvantvtplmkaqsvpgmavaviyqgkphyytfgkadiaankpvtpqtlfel gsisktftgvlggdaiargeislddpvtrywpqltgkqwqgirmldlatytagglplqvp devtdnaslvrfyqnwqpqwkpgttrlyanasiglfgalavkpsgmpyeqamttrvlkpl kldhtwinvpkaeeahyawgyrdgkavrvspgmldaqaygvktnvqdmanwvmanmapen vadaslkqgialaqsrywrigsmyqglgwemlnwpveantvvegsdskvalaplpvvevn ppappvkaswvhktgstggfgsyvafipekqigivmlantsypnparveaayhilealq
Timeline for d1s6ra_: