Lineage for d1s6la2 (1s6l A:81-212)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2216874Fold d.357: NosL/MerB-like [160386] (1 superfamily)
    unusual fold; comprises two structural repeats of beta(2)-alpha-beta motifs, forming separate beta-sheets; probable duplication
  4. 2216875Superfamily d.357.1: NosL/MerB-like [160387] (2 families) (S)
  5. 2216881Family d.357.1.2: MerB-like [160391] (1 protein)
    Pfam PF03243
  6. 2216882Protein Alkylmercury lyase MerB [160392] (1 species)
  7. 2216883Species Escherichia coli [TaxId:562] [160393] (17 PDB entries)
    Uniprot P77072 81-212
  8. 2216896Domain d1s6la2: 1s6l A:81-212 [145774]
    Other proteins in same PDB: d1s6la1

Details for d1s6la2

PDB Entry: 1s6l (more details)

PDB Description: Solution structure of MerB, the Organomercurial Lyase involved in the bacterial mercury resistance system
PDB Compounds: (A:) Alkylmercury lyase

SCOPe Domain Sequences for d1s6la2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s6la2 d.357.1.2 (A:81-212) Alkylmercury lyase MerB {Escherichia coli [TaxId: 562]}
tsyvfeiddrrlyawcaldtlifpaligrtarvsshcaatgapvsltvspseiqavepag
mavslvlpqeaadvrqsfcchvhffasvptaedwaskhqgleglaivsvheafglgqefn
rhllqtmssrtp

SCOPe Domain Coordinates for d1s6la2:

Click to download the PDB-style file with coordinates for d1s6la2.
(The format of our PDB-style files is described here.)

Timeline for d1s6la2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1s6la1