Lineage for d1s4vb_ (1s4v B:)
- Root: SCOPe 2.04
Class d: Alpha and beta proteins (a+b) [53931] (380 folds) 
Fold d.3: Cysteine proteinases [54000] (1 superfamily)
consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-AsnSuperfamily d.3.1: Cysteine proteinases [54001] (23 families) 
the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
Family d.3.1.1: Papain-like [54002] (26 proteins) 
Protein Vignain (bean endopeptidase) [102719] (1 species) Species Castor bean (Ricinus communis) [TaxId:3988] [102720] (1 PDB entry) 
Domain d1s4vb_: 1s4v B: [98512]
complexed with so4
Details for d1s4vb_
PDB Entry: 1s4v (more details), 2 Å
PDB Description: The 2.0 A crystal structure of the KDEL-tailed cysteine endopeptidase functioning in programmed cell death of Ricinus communis endosperm
PDB Compounds: (B:) cysteine endopeptidaseSCOPe Domain Sequences for d1s4vb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s4vb_ d.3.1.1 (B:) Vignain (bean endopeptidase) {Castor bean (Ricinus communis) [TaxId: 3988]}
tvpasvdwrkkgavtsvkdqgqcgscwafstivaveginqiktnklvslseqelvdcdtd
qnqgcngglmdyafefikqrggitteanypyeaydgtcdvskenapavsidghenvpend
enallkavanqpvsvaidaggsdfqfysegvftgscgteldhgvaivgygttidgtkywt
vknswgpewgekgyirmergisdkeglcgiameasypikkssnnps
SCOPe Domain Coordinates for d1s4vb_:
Click to download the PDB-style file with coordinates for d1s4vb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1s4vb_:
- d1s4vb_ first appeared in SCOP 1.67
- d1s4vb_ appears in SCOPe 2.03
- d1s4vb_ appears in SCOPe 2.05
- d1s4vb_ appears in the current release, SCOPe 2.08
View in 3D
