Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) |
Family d.14.1.5: GHMP Kinase, N-terminal domain [54232] (7 proteins) |
Protein Galactokinase [102762] (3 species) |
Species Pyrococcus furiosus [TaxId:2261] [102764] (1 PDB entry) |
Domain d1s4ed1: 1s4e D:2-180 [98483] Other proteins in same PDB: d1s4ea2, d1s4eb2, d1s4ec2, d1s4ed2, d1s4ee2, d1s4ef2, d1s4eg2, d1s4eh2, d1s4ei2 complexed with adp, gla, mg |
PDB Entry: 1s4e (more details), 2.9 Å
SCOPe Domain Sequences for d1s4ed1:
Sequence, based on SEQRES records: (download)
>d1s4ed1 d.14.1.5 (D:2-180) Galactokinase {Pyrococcus furiosus [TaxId: 2261]} skitvkspgrvnligehtdytygyvmpmaidlytiitaekydkvqlysehfneektftld nltkegswidyvkgvlwvliqegykigglkgkitgdlplgaglsssasfevgilevlnql ynlnidplkkallakkaenefvgvpcgildqfavvfgkkdnvifldtqtlqyeyipfpk
>d1s4ed1 d.14.1.5 (D:2-180) Galactokinase {Pyrococcus furiosus [TaxId: 2261]} skitvkspgrvnligehtdytygyvmpmaidlytiitaekydkvqlysehfneektftld tkegswidyvkgvlwvliqegykigglkgkitgdlplgaglsssasfevgilevlnqlyn lnidplkkallakkaenefvgvpcgildqfavvfgkkdnvifldtqtlqyeyipfpk
Timeline for d1s4ed1: