Lineage for d1s3tb_ (1s3t B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2817864Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2817976Superfamily b.85.3: Urease, beta-subunit [51278] (2 families) (S)
  5. 2817977Family b.85.3.1: Urease, beta-subunit [51279] (2 proteins)
  6. 2817978Protein Urease, beta-subunit [51280] (4 species)
  7. 2817979Species Bacillus pasteurii [TaxId:1474] [51282] (18 PDB entries)
  8. 2817996Domain d1s3tb_: 1s3t B: [98461]
    Other proteins in same PDB: d1s3ta_, d1s3tc1, d1s3tc2
    complexed with bo3, ni, so4

Details for d1s3tb_

PDB Entry: 1s3t (more details), 2.1 Å

PDB Description: borate inhibited bacillus pasteurii urease crystal structure
PDB Compounds: (B:) urease beta subunit

SCOPe Domain Sequences for d1s3tb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s3tb_ b.85.3.1 (B:) Urease, beta-subunit {Bacillus pasteurii [TaxId: 1474]}
nyivpgeyrvaegeieinagrekttirvsntgdrpiqvgshihfvevnkellfdraegig
rrlnipsgtaarfepgeemeveltelggnrevfgisdltngsvdnkelilqrakelgykg
ve

SCOPe Domain Coordinates for d1s3tb_:

Click to download the PDB-style file with coordinates for d1s3tb_.
(The format of our PDB-style files is described here.)

Timeline for d1s3tb_: