Lineage for d1s2nb_ (1s2n B:)
- Root: SCOPe 2.04
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.41: Subtilisin-like [52742] (1 superfamily)
3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3Superfamily c.41.1: Subtilisin-like [52743] (3 families) 
Family c.41.1.0: automated matches [191390] (1 protein)
not a true familyProtein automated matches [190500] (7 species)
not a true proteinSpecies Vibrio sp. [TaxId:210249] [188018] (2 PDB entries) 
Domain d1s2nb_: 1s2n B: [161705]
automated match to d1bjre_
complexed with ca, pms
Details for d1s2nb_
PDB Entry: 1s2n (more details), 2.44 Å
PDB Description: crystal structure of a cold adapted subtilisin-like serine proteinase
PDB Compounds: (B:) extracellular subtilisin-like serine proteinaseSCOPe Domain Sequences for d1s2nb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s2nb_ c.41.1.0 (B:) automated matches {Vibrio sp. [TaxId: 210249]}
snaiwgldridqrnlpldrnynanfdgfgvtayvidtgvnnnheefggrsvsgydfvdnd
adssdcnghgthvagtiggsqygvaknvnivgvrvlscsgsgttsgvisgvdwvaqnasg
psvanmslgggqstaldsavqgaiqsgvsfmlaagnsnadacntsparvpsgvtvgstts
sdsrssfsnwgscvdlfapgsqiksawydggyktisgtsmatphvagvaalylqennglt
plqltgllnsrasenkvsdtrgttnkllyslad
SCOPe Domain Coordinates for d1s2nb_:
Click to download the PDB-style file with coordinates for d1s2nb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1s2nb_:
- d1s2nb_ first appeared in SCOPe 2.01
- d1s2nb_ appears in SCOPe 2.03
- d1s2nb_ appears in SCOPe 2.05
- d1s2nb_ appears in the current release, SCOPe 2.08
View in 3D
