Lineage for d1s29a_ (1s29 A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1720410Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1721437Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1722528Family a.4.5.46: La domain [101051] (2 proteins)
    Pfam PF05383; RNA-binding domain
  6. 1722532Protein Lupus La autoantigen N-terminal domain [101052] (2 species)
  7. 1722546Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [101054] (1 PDB entry)
  8. 1722547Domain d1s29a_: 1s29 A: [98373]

Details for d1s29a_

PDB Entry: 1s29 (more details), 1.6 Å

PDB Description: La autoantigen N-terminal domain
PDB Compounds: (A:) La protein

SCOPe Domain Sequences for d1s29a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s29a_ a.4.5.46 (A:) Lupus La autoantigen N-terminal domain {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
gshmplssenkqklqkqvefyfsdvnvqrdiflkgkmaenaegfvsletlltfkrvnsvt
tdvkevveairpseklvlsedglmvrrrdplp

SCOPe Domain Coordinates for d1s29a_:

Click to download the PDB-style file with coordinates for d1s29a_.
(The format of our PDB-style files is described here.)

Timeline for d1s29a_: