Class b: All beta proteins [48724] (174 folds) |
Fold b.122: PUA domain-like [88696] (1 superfamily) pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other |
Superfamily b.122.1: PUA domain-like [88697] (14 families) |
Family b.122.1.6: ProFAR isomerase associated domain [117351] (3 proteins) Pfam PF07060; DUF1530 |
Protein Hypothetical protein PF0455 [117354] (1 species) |
Species Pyrococcus furiosus [TaxId:2261] [117355] (1 PDB entry) Uniprot Q8U3L1 |
Domain d1s04a_: 1s04 A: [112002] Structural genomics target |
PDB Entry: 1s04 (more details)
SCOPe Domain Sequences for d1s04a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s04a_ b.122.1.6 (A:) Hypothetical protein PF0455 {Pyrococcus furiosus [TaxId: 2261]} mewemglqeefleliklrkkkiegrlydekrrqikpgdvisfeggklkvrvkairvynsf remlekeglenvlpgvksieegiqvyrrfydeekekkygvvaieiepley
Timeline for d1s04a_: