Lineage for d1s04a_ (1s04 A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1335534Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 1335535Superfamily b.122.1: PUA domain-like [88697] (14 families) (S)
  5. 1335653Family b.122.1.6: ProFAR isomerase associated domain [117351] (3 proteins)
    Pfam PF07060; DUF1530
  6. 1335654Protein Hypothetical protein PF0455 [117354] (1 species)
  7. 1335655Species Pyrococcus furiosus [TaxId:2261] [117355] (1 PDB entry)
    Uniprot Q8U3L1
  8. 1335656Domain d1s04a_: 1s04 A: [112002]
    Structural genomics target

Details for d1s04a_

PDB Entry: 1s04 (more details)

PDB Description: solution nmr structure of protein pf0455 from pyrococcus furiosus. northeast structural genomics consortium target pfr13
PDB Compounds: (A:) hypothetical protein PF0455

SCOPe Domain Sequences for d1s04a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s04a_ b.122.1.6 (A:) Hypothetical protein PF0455 {Pyrococcus furiosus [TaxId: 2261]}
mewemglqeefleliklrkkkiegrlydekrrqikpgdvisfeggklkvrvkairvynsf
remlekeglenvlpgvksieegiqvyrrfydeekekkygvvaieiepley

SCOPe Domain Coordinates for d1s04a_:

Click to download the PDB-style file with coordinates for d1s04a_.
(The format of our PDB-style files is described here.)

Timeline for d1s04a_: