Lineage for d1rz7l1 (1rz7 L:2-107)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) 
Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88520] (19 PDB entries) 
Domain d1rz7l1: 1rz7 L:2-107 [98135]
Other proteins in same PDB: d1rz7h1, d1rz7h2, d1rz7l2
part of anti HIV-1 gp120-reactive Fab 48D
complexed with gol
Details for d1rz7l1
PDB Entry: 1rz7 (more details), 2 Å
PDB Description: crystal structure of human anti-hiv-1 gp120-reactive antibody 48d
PDB Compounds: (L:) Fab 48d light chainSCOPe Domain Sequences for d1rz7l1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rz7l1 b.1.1.1 (L:2-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 1 [TaxId: 9606]}
iqmtqspssvsasvgdrvtitcrasqdistwlawyqqkpgkapklliyaastlqsgvpsr
fsgsgsgtdfsltinslqpedfatyycqqansfftfgggtkveik
SCOPe Domain Coordinates for d1rz7l1:
Click to download the PDB-style file with coordinates for d1rz7l1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1rz7l1:
- d1rz7l1 first appeared in SCOP 1.67
- d1rz7l1 appears in SCOPe 2.04
- d1rz7l1 appears in SCOPe 2.06
- d1rz7l1 appears in the current release, SCOPe 2.08
View in 3D
