Lineage for d1ryhb_ (1ryh B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1593542Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1593543Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1594390Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1595072Protein Rac [52595] (1 species)
  7. 1595073Species Human (Homo sapiens) [TaxId:9606] [52596] (17 PDB entries)
  8. 1595076Domain d1ryhb_: 1ryh B: [98103]
    alternative splicing variant of rac1
    complexed with gnp, mg

Details for d1ryhb_

PDB Entry: 1ryh (more details), 1.75 Å

PDB Description: Alternative Splicing of Rac1 Generates Rac1b, a Self-activating GTPase
PDB Compounds: (B:) ras-related C3 botulinum toxin substrate 1 isoform Rac1b

SCOPe Domain Sequences for d1ryhb_:

Sequence, based on SEQRES records: (download)

>d1ryhb_ c.37.1.8 (B:) Rac {Human (Homo sapiens) [TaxId: 9606]}
gsmqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdt
agqedydrlrplsypqtvgetygkditsrgkdkpiadvflicfslvspasfenvrakwyp
evrhhcpntpiilvgtkldlrddkdtieklkekkltpitypqglamakeigavkylecsa
ltqrglktvfdeairavlcpp

Sequence, based on observed residues (ATOM records): (download)

>d1ryhb_ c.37.1.8 (B:) Rac {Human (Homo sapiens) [TaxId: 9606]}
gsmqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdt
iadvflicfslvspasfenvrakwypevrhhcpntpiilvgtkldlrddkdtieklkekk
ltpitypqglamakeigavkylecsaltqrglktvfdeairavlcpp

SCOPe Domain Coordinates for d1ryhb_:

Click to download the PDB-style file with coordinates for d1ryhb_.
(The format of our PDB-style files is described here.)

Timeline for d1ryhb_: