Lineage for d1rqua1 (1rqu A:1-51)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1278323Fold a.108: Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48299] (1 superfamily)
    multihelical; intertwined tetramer
  4. 1278324Superfamily a.108.1: Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48300] (1 family) (S)
  5. 1278325Family a.108.1.1: Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48301] (1 protein)
  6. 1278326Protein Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48302] (2 species)
  7. 1278327Species Escherichia coli [TaxId:562] [101379] (5 PDB entries)
  8. 1278332Domain d1rqua1: 1rqu A:1-51 [97773]
    Other proteins in same PDB: d1rqua2, d1rqub2
    includes hinge region 33-51 that is flexible in both chains

Details for d1rqua1

PDB Entry: 1rqu (more details)

PDB Description: nmr structure of l7 dimer from e.coli
PDB Compounds: (A:) 50S ribosomal protein L7/L12

SCOPe Domain Sequences for d1rqua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rqua1 a.108.1.1 (A:1-51) Ribosomal protein L7/12, oligomerisation (N-terminal) domain {Escherichia coli [TaxId: 562]}
sitkdqiieavaamsvmdvvelisameekfgvsaaaavavaagpveaaeek

SCOPe Domain Coordinates for d1rqua1:

Click to download the PDB-style file with coordinates for d1rqua1.
(The format of our PDB-style files is described here.)

Timeline for d1rqua1:

1278332
d1rqua1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1rqua2