Class a: All alpha proteins [46456] (286 folds) |
Fold a.128: Terpenoid synthases [48575] (1 superfamily) multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers |
Superfamily a.128.1: Terpenoid synthases [48576] (6 families) duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J |
Family a.128.1.1: Isoprenyl diphosphate synthases [48577] (4 proteins) |
Protein Farnesyl diphosphate synthase (geranyltranstransferase) [48578] (3 species) |
Species Escherichia coli [TaxId:562] [101453] (2 PDB entries) |
Domain d1rqjb_: 1rqj B: [97745] complexed with ipe, mg, ris |
PDB Entry: 1rqj (more details), 1.95 Å
SCOPe Domain Sequences for d1rqjb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rqjb_ a.128.1.1 (B:) Farnesyl diphosphate synthase (geranyltranstransferase) {Escherichia coli [TaxId: 562]} dfpqqleacvkqanqalsrfiaplpfqntpvvetmqygallggkrlrpflvyatghmfgv stntldapaaavecihayslihddlpamddddlrrglptchvkfgeanailagdalqtla fsilsdadmpevsdrdrismiselasasgiagmcggqaldldaegkhvpldalerihrhk tgaliraavrlgalsagdkgrralpvldkyaesiglafqvqddildvvgdtatlgkrqga dqqlgkstypallgleqarkkardliddarqslkqlaeqsldtsalealadyiiqrnk
Timeline for d1rqjb_: