Lineage for d1rl6a1 (1rl6 A:7-81)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1219397Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
    consists of two beta-sheets and one alpha-helix packed around single core
  4. 1219398Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family) (S)
  5. 1219399Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)
  6. 1219400Protein Ribosomal protein L6 [56055] (6 species)
    duplication: consists of two domains of this fold
  7. 1219401Species Bacillus stearothermophilus [TaxId:1422] [56056] (1 PDB entry)
  8. 1219402Domain d1rl6a1: 1rl6 A:7-81 [41473]

Details for d1rl6a1

PDB Entry: 1rl6 (more details), 2 Å

PDB Description: ribosomal protein l6
PDB Compounds: (A:) protein (ribosomal protein l6)

SCOPe Domain Sequences for d1rl6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rl6a1 d.141.1.1 (A:7-81) Ribosomal protein L6 {Bacillus stearothermophilus [TaxId: 1422]}
pieipagvtvtvngntvtvkgpkgeltrtfhpdmtitvegnvitvtrpsdekhhralhgt
trsllanmvegvskg

SCOPe Domain Coordinates for d1rl6a1:

Click to download the PDB-style file with coordinates for d1rl6a1.
(The format of our PDB-style files is described here.)

Timeline for d1rl6a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rl6a2