Lineage for d1rl2b1 (1rl2 B:126-196)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 665027Fold b.34: SH3-like barrel [50036] (18 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 665509Superfamily b.34.5: Translation proteins SH3-like domain [50104] (6 families) (S)
    many known members contain KOW motif
  5. 665631Family b.34.5.3: C-terminal domain of ribosomal protein L2 [50114] (1 protein)
  6. 665632Protein C-terminal domain of ribosomal protein L2 [50115] (2 species)
  7. 665674Species Bacillus stearothermophilus [TaxId:1422] [50116] (2 PDB entries)
  8. 665676Domain d1rl2b1: 1rl2 B:126-196 [24611]
    Other proteins in same PDB: d1rl2a2, d1rl2b2
    mutant

Details for d1rl2b1

PDB Entry: 1rl2 (more details), 2.3 Å

PDB Description: ribosomal protein l2 rna-binding domain from bacillus stearothermophilus
PDB Compounds: (B:) protein (ribosomal protein l2)

SCOP Domain Sequences for d1rl2b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rl2b1 b.34.5.3 (B:126-196) C-terminal domain of ribosomal protein L2 {Bacillus stearothermophilus [TaxId: 1422]}
gnalplenipvgtlvhnielkpgrggqlvraagtsaqvlgkegkyvivrlasgevrmilg
kcratvgevgn

SCOP Domain Coordinates for d1rl2b1:

Click to download the PDB-style file with coordinates for d1rl2b1.
(The format of our PDB-style files is described here.)

Timeline for d1rl2b1:

665676
d1rl2b1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1rl2b2