SCOPe 2.04: Domain d1rhha2: 1rhh A:107-213

Lineage for d1rhha2 (1rhh A:107-213)

Root: SCOPe 2.04
Class b: All beta proteins [48724] (176 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)

Species Human (Homo sapiens) [TaxId:9606] [88569] (144 PDB entries)
including humanized antibodies (chimeric proteins with human constant domains)
SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody

Domain d1rhha2: 1rhh A:107-213 [97474]
Other proteins in same PDB: d1rhha1, d1rhhb1, d1rhhb2, d1rhhc1, d1rhhd1, d1rhhd2
part of HIV-1 neutralizing Fab x5

Details for d1rhha2

PDB Entry: 1rhh (more details), 1.9 Å

PDB Description: Crystal Structure of the Broadly HIV-1 Neutralizing Fab X5 at 1.90 Angstrom Resolution

PDB Compounds: (A:) Fab X5, light chain

SCOPe Domain Sequences for d1rhha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rhha2 b.1.1.2 (A:107-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
srdstyslgstltlskadyekhkvyacevthqglsspvtksfnrgec

SCOPe Domain Coordinates for d1rhha2:

Click to download the PDB-style file with coordinates for d1rhha2.
(The format of our PDB-style files is described here.)

Timeline for d1rhha2: